PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009618484.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 795aa    MW: 90463.4 Da    PI: 6.2854
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009618484.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK49.58.4e-16441486348
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                     + isledl++++ ++ ++AA +L+v++++ KriCR++GI+RWP  k
  XP_009618484.1 441 DMISLEDLQQNYGKKREEAAESLQVSVSTFKRICRKFGIDRWPTAK 486
                     679****************************************866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151912.957422512IPR003035RWP-RK domain
PfamPF020425.9E-16443489IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 795 aa     Download sequence    Send to blast
MCEQHKTLEF GTEEYNSNSN YGIPIPTQDV GFWQAECYSE IPAGSNFDIP SSSSNNLPGY  60
INFPANSTYN ENVEIIHDSF GKAAADQVVS RKLFCFANGH VLDPQRVDLF YLDLSKRAYQ  120
VTIHRHNGFD FFSLTKVVDV SDLFQLLKVF LSSKLRLMFL IDDEYSLLTD ELNLVVTGQR  180
IAGAYYTGLP GTANLDFPLL QPHLQMEVKL AFSLQNLMRS TMHYAISQAY SSRMTKSQNV  240
KSFVVCECEN ELFLDHCREN SSQSIQSFIP FGGNIKLSPC RVASVVYSLY LYGEVQENFS  300
ILGRVVDVSF SSVKFSYRTD PHSSPGHSQD YHFHGILSLS LLVPTEQSPV EFFEIVYCPQ  360
RAHLTSKDQR SPGTNKQKQY GLSPCLDSAV VQSSSNERQM LLEAFEDDAI YSHESQEVVA  420
ESQTNIQKKR KKSSTMWTAA DMISLEDLQQ NYGKKREEAA ESLQVSVSTF KRICRKFGID  480
RWPTAKRNKD KCLFSARKCD APLIAKVRTS QLLQNGMPCE DRETTCISRP KRKGKEKEAA  540
DNIEAINHFE EQPSEIQNRT PKRQAVDCAT KDSSCLNSIT GYVVDDMVST RMGVQAYLEA  600
ISIEQLNSIS CNENTSQNTK LLFDNLIALP LKDLINPEKE IYMKETLCIL AENLSFFSVE  660
QAKQIVELKF DFSTLVHSWR EYSQSQVCSQ KFFEDLERNR TLLATSAKDE ESLKVRYDEL  720
QSKKKELMAQ FEVVQKEQEG IAEQRREKTE QKKHLVSLAK EKASRTKEKQ LVMTIASAKL  780
NNLVDQWAAI QSLFM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1427431KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618484.10.0PREDICTED: uncharacterized protein LOC104110657 isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1552844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.13e-11Nin-like family protein